":setlocal spell spelllang=en :set cpoptions=ces$ set nowrap set background=dark set term=ansi "GVIM stuff... :set guifont=Courier\ 14 set noautoindent set nobackup set comments=b:#,:%,fb:-,n:>,n:) set dictionary=/usr/dict/words set digraph set noerrorbells set esckeys set noexpandtab set formatoptions=cqrt set helpheight=0 set hidden set highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws "set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws " " hlsearch : highlight search - show the current search pattern " This is a nice feature sometimes - but it sure can get in the " way sometimes when you edit. set nohlsearch " " icon: ... set noicon " " set iconstring file of icon (icons? on a terminal? pff!) " set iconstring " " ignorecase: ignore the case in search patterns? NO! set noignorecase " " insertmode: " FAQ: Q: How can I quit insertmode when using this option? " A: The option "insertmode" was not meant for "start Vim in " insert mode" only; the idea is to *stay* in insert mode. " Anyway, you can use the command |i_CTRL-O| to issue commands. set noinsertmode " " " iskeyword: " iskeyword=@,48-57,_,192-255 (default) " Add the dash ('-'), the dot ('.'), and the '@' as "letters" to "words". " This makes it possible to expand email addresses, eg " guckes-www@vim.org " set iskeyword=@,48-57,_,192-255,-,.,@-@ " " joinspaces: " insert two spaces after a period with every joining of lines. " I like this as it makes reading texts easier (for me, at least). set joinspaces " " keywordprg: Program to use for the "K" command. " set keywordprg=man\ -s " " laststatus: show status line? Yes, always! " laststatus: Even for only one buffer. set laststatus=2 " " [VIM5]lazyredraw: do not update screen while executing macros set lazyredraw " " 'list' + 'listchars': Great new feature of vim-5.3! " This tells Vim which characters to show for expanded TABs, " trailing whitespace, and end-of-lines. VERY useful!! " set list " set listchars=tab:>-,trail:·,eol:$ " The '$' at the end of lines is a bit too much, though. " And I quite like the character that shows a dot in the middle: " set listchars=tab:>·,trail:· " Some people might prefer a double right angle (>>) " to show the start of expanded tabs, though: " set listchars=tab:»·,trail:· " However, this all breaks up when viewing high-bit characters " through some brain-dead telnet program (there are many). " " magic: Use 'magic' patterns (extended regular expressions) " in search patterns? Certainly! (I just *love* "\s\+"!) set magic " " modeline: ... " Allow the last line to be a modeline - useful when " the last line in sig gives the preferred textwidth for replies. set modeline set modelines=1 " " number: ... set nonumber " " path: The list of directories to search when you specify " a file with an edit command. " Note: "~/.P" is a symlink to my dir with www pages " "$VIM/syntax" is where the syntax files are. set path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIM/syntax/ " set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn " " pastetoggle " set pastetoggle= " " report: show a report when N lines were changed. " report=0 thus means "show all changes"! set report=0 " " ruler: show cursor position? Yep! set ruler " " Setting the "shell" is always tricky - especially when you are " trying to use the same vimrc on different operatin systems. " shell for DOS " set shell=command.com " shell for UNIX - math.fu-berlin.de BSD " set shell=zsh " shell for UNIX - inf.fu-berlin.de BSD&Solaris " set shell=zsh " shell for UNIX - zedat.fu-berlin.de BSD&Solaris " set shell=/bin/tcsh " Now that vim-5 has ":if" I am trying to automate the setting: " set shell=/bin/tcsh if has("dos16") || has("dos32") let shell='command.com' endif " The zsh is now available at zedat.fu-berlin.de! :-) " start the zsh as a login shell: " if has("unix") " let &shell="zsh\ -l" " endif " " shiftwidth: Number of spaces to use for each " insertion of (auto)indent. " set shiftwidth=2 " " shortmess: Kind of messages to show. Abbreviate them all! " New since vim-5.0v: flag 'I' to suppress "intro message". set shortmess=at " " showcmd: Show current uncompleted command? Absolutely! set showcmd " " showmatch: Show the matching bracket for the last ')'? set showmatch " " showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS! set showmode " " suffixes: Ignore filename with any of these suffixes " when using the ":edit" command. " Most of these are files created by LaTeX. set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar " " startofline: no: do not jump to first character with page " commands, ie keep the cursor in the current column. set nostartofline " set splitbelow " " statusline: customize contents of the windows' status line. " I prfer it this way: " Show the current buffer number and filename with info on " modification, read-only, and whether it is a help buffer " (show only when applied). " set statusline=[%n]\ %f\ %(\ %M%R%H)%) " " Move the rest to the right side, eg a copyright text: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)%=(c)\ Sven\ Guckes " " Show the value of the current character in ASCII and Hex: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=ASCII=%b\ HEX=%B " " Show the current position with line+column+virtual_column: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=Pos=<%l\,%c%V>\ %P " Adding color through UserN groups: " set statusline=%1*[%02n]%*\ %2*%F%*\ %(\ %M%R%H)%)%=%3*Pos=<%l,%c%V>%* " User1: color for buffer number " hi User1 ctermfg=red ctermbg=white " User2: color for filename " hi User2 ctermfg=green ctermbg=white " User3: color for position " hi User3 ctermfg=blue ctermbg=white " " tabstop set tabstop=8 " " 990503: I have to set the "term" explicitly " because the standard setups are broken. " set term=builtin_pcansi " set term=xterm " " Set the colors for vim on "xterm" " if &term=="xterm" " set t_Co=16 " set t_AB=[%?%p1%{8}%<%t%p1%{40}%+%e%p1%{92}%+%;%dm " set t_AF=[%?%p1%{8}%<%t%p1%{30}%+%e%p1%{82}%+%;%dm " endif " " textmode: no - I am using Vim on UNIX! set notextmode " " textwidth " set textwidth=79 " " title: " set notitle " " ttyfast: are we using a fast terminal? " seting depends on where I use Vim... set ttyfast " " ttybuiltin: set nottybuiltin " " ttyscroll: turn off scrolling -> faster! set ttyscroll=0 " " ttytype: " set ttytype=rxvt " " viminfo: What info to store from an editing session " in the viminfo file; can be used at next session. " set viminfo=%,'50,\"100,:100,n~/.viminfo set viminfo="NONE" " " visualbell: " set visualbell " " t_vb: terminal's visual bell - turned off to make Vim quiet! " Please use this as to not annoy cow-orkers in the same room. " Thankyou! :-) set t_vb= " " whichwrap: " set whichwrap=<,>,h,l " " wildchar the char used for "expansion" on the command line " default value is "" but I prefer the tab key: set wildchar= " " wrapmargin: " set wrapmargin=1 " " writebackup: set nowritebackup " " =================================================================== " ABbreviations " =================================================================== " 980701: Moved the abbreviations *before* the mappings as " some of the abbreviations get used with some mappings. " " Abbreviations for some important numbers: iab Npi 3.1415926535897932384626433832795028841972 iab Ne 2.7182818284590452353602874713526624977573 " " Abbreviations for some classic long words: " " Donau... is the German word for the (read in reverse) " "additional paragraph of the law regulating the pension of " widows to captains of the ship company on (the river) Danube" " (I am not making this up! ;-) iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph " " YLL : The name of a town in Wales. I am not making this up! iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch " http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk " http://194.159.85.168/ - I am not making this up! :-) " " YTauma: The name of a hill in New Zealand. iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu " " Yalpha : The lower letter alphabet. iab Yalpha abcdefghijklmnopqrstuvwxyz " " YALPHA : The upper letter alphabet. iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ " " Ydigit : The ten digits. iab Ydigit 1234567890 " " Yruler : A ruler. iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890 " " Yupsidedown : This describes people from "down under" (Hi, Dean!). iab Yupsidedown umop-ap!sdn " " Ysuper: A nice long word from the musical "Mary Poppins". iab Ysuper supercalifragilisticexpialidocious " " Yanti: The longest proper word in the English language?! iab Yanti antidisestablishmentarianism " " Ypass : Standard answer to Usenet posts " with the "Subject: HELP" (hehe) iab Ypass "You are in a maze of twisty little passages, all alike." " " Yicty: Some people should really RTFM! iab Yicty I could tell you - but then I'd have to kill you. " " Ybtdt: It's been dejavu all over again. iab Ybtdt Been there, done that, got the tshirt. " " Ysesqui : "Sesquipedalophobia" means "fear of big words." ;-) iab Ysesqui sesquipedalophobia " " Yi18n 123456789012345678 - yup, 18 characters betwwen 'i' and 'n' iab Yi18n internationalization " " classic pangrams (which include every letter of the alphabet): " German: " sylvia wagt quick den jux bei pforzheim " bayerische jagdwitze von maxl querkopf " zwei boxkaempfer jagen eva quer durch sylt " kaufen sie jede woche vier gute bequeme pelze " falsches üben von xylophonmusik quält jeden größeren zwerg. " Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch! " English: " the quick brown fox jumps over the lazy dog " French: " voyez le brick geant que j'examine pres du wharf. " " And a sentence to break some quoing levels: " "This man's house (which 's yellow) burned down." " " And now for something completely different: " I couldn't bear to bear bears over the border. " " Inserting an ellipsis to indicate deleted text iab Yell [...] vmap ,ell c[...] " " Correcting those typos. [I almost never get these right. :-(] " See also: http://www.igd.fhg.de/~zach/programs/acl/ iab alos also iab aslo also iab bianry binary iab bianries binaries iab charcter character iab charcters characters iab exmaple example iab exmaples examples iab shoudl should iab seperate separate iab teh the iab tpyo typo " Some frequent typos in German: iab nciht nicht iab doer oder iab Dreckfuhler Druckfehler " Sorry, Laurent! iab Laurant Laurent " " See http://www.math.fu-berlin.de/~guckes/sig/: iab YDDS dash-dash-space " " For reports and texts on my studies: iab YKT Komplexitaetstheorie iab YRA Rechnerarchitektur iab YPM Pattern Matching " see http://elib.zib.de/ICM98 : iab YICM International Congress of Mathematicians " " Some sentences that I really use often in emails about Vim: iab YAW You are welcome! :-) iab YEV Enjoy Vim! " " Often used filenames - only needed these on the command line: " see also: http://www.math.fu-berlin.de/~guckes/setup/ " " cab ELMALIAS ~/.elm/aliases.text " cab Erc ~/.elm/elmrc " cab Mrc ~/.muttrc " cab Src ~/.slrnrc " cab Zrc ~/.zsh/.zshrc " " A list of filenames that are needed to shorten some autocommands: " cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/* " cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt* " let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*" " " Email Adresses: " I usually use these when adding addresses to the header " of emails (mutt) and posts (slrn). " " Author of the Good NetKeeping Seal of Approval: " ab Agnksa js@xs4all.nl (Jeroen Scheerder) " " Author of Mutt: " ab Amutt me@cs.hmc.edu (Michael Elkins) " " Author of Slrn: " ab Aslrn davis@space.mit.edu (John E. Davis) " " Author of Vim: " ab Avim mool@oce.nl (Bram Moolenaar) " Author of Vim - vim specific address: " ab Avim bram@vim.org (Bram Moolenaar) " Author of Vim - private address: " ab Abram Bram@Moolenaar.net (Bram Moolenaar) " " Former Maintainer of the Vim FAQ: " ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval) " " Mailing Lists (MLs) " " The Vim mailing lists: See http://www.vim.org/mail.html for more info! " ab MLvim vim@vim.org (VIM Help List) " ab MLvimdev vim-dev@vim.org (VIM Development List) " ab MLvimmac guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List) "" " More mailing lists: " ab MLgnksa gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List) " ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List) " ab MLmuttuser mutt-users@mutt.org (Mutt Users List) " ab MLzsh zsh-users@math.gatech.edu (ZShell Users List) " moved to sunsite.auc.dk on 990124: " ab MLzsh zsh-users@sunsite.auc.dk (ZShell Users List) " " " News: newsgroup names " " Newsgroup about "warloding" of signatures - see " also http://www.math.fu-berlin.de/~guckes/afw/ " iab Nafw alt.fan.warlord " iab Nahbou alt.humor.best-of-usenet " iab Nzedat bln.announce.fub.zedat.d " iab Ncsd bln.announce.fub.cs.d " iab Nce comp.editors " Newsgroup about "lynx": " iab Nhtml comp.infosystems.www.authoring.html " Newsgroup about "elm": Elm is dead - long live Mutt! " iab Nelm comp.mail.elm " Newsgroup about "pine": When will they release pine-4? " iab Ncmp comp.mail.pine " iab Npine comp.mail.pine " iab Ncsmd comp.sys.mac.digest " Newsgroup about "mobil phone systems": " iab Ndcm de.comm.mobil " iab Nmobil de.comm.mobil " Newsgroup about "web browsers": " iab Nlynx comp.infosystems.www.browsers.misc " iab Nnetscape comp.infosystems.www.browsers.misc " Newsgroup about "mutt" [since 980401]: The coolest mail user agent " iab Nmutt comp.mail.mutt " Newsgroup about "nn": Once was the best newsreader. Still good. " iab Nnn news.software.nn " Newsgroup for "newbies". " All you ever wanted to know - but were afraid to ask. ;-) " iab Newbie news.newusers.questions " Newsgroup about "newsreader *agents*" (netscape and slrn): " iab Nnsr news.software.readers " " Usenet header lines (used when composing a post): " iab UFT Followup-To: iab UMCT Mail-Copies-To: MYADDR iab UNG Newsgroups: iab URT Reply-To: MYADDR iab UFUB Organization: Freie Universitaet Berlin " " Current version numbers of my favourite programs: " http://www.math.fu-berlin.de/~guckes/sig/SIGS " And some abbreviations to type them in mail&news: " [Last update: 990707] iab Velm ELM2.4PL25 [951204] iab VElm ELM2.5 [990324] iab Vlynx lynx-2.8.1 [980310] iab Vmutt mutt-0.96.3 [990603] iab Vslrn slrn-0.9.5.6 [990503] iab Vvim vim-5.4n [990704] iab Vvimdev vim-5.3 [980817] " " My snail mail address, phone numbers, and email->pager gateway: " Postcards and FAXes are welcome (especially with cartoons :-). " If you want, you can send a message to my pager by email, too. " iab Yphone TEL/FAX (+49 30) 8838884Cellphone (+49 177) 7777796 iab Yphone TEL/FAX (+49 30) 8838884Cellphone (+49 179) 3966141 iab Ysnail Sven GuckesPariser Str. 52D-10719 Berlin iab YICQ ICQ:38801898 " " My addresses (Email and WWW) " makes it easy to type them without typos ;-) " ab Amaili guckes@inf.fu-berlin.de " ab Amailm guckes@math.fu-berlin.de " ab Amailv guckes@vim.org " ab Amailz guckes@zedat.fu-berlin.de "" ab Apriv sven@guckes.net " ab MYADDR guckes@math.fu-berlin.de " ab MYNAME Sven Guckes " ab MYDOMAIN math.fu-berlin.de "" ab MYDOMAIN guckes.net " " Setting the reply address when replying as the guy from SKB: " ab ASKB Sprachboerse " See also: http://www.math.fu-berlin.de/~guckes/skb/ " " My Home Pages at the departments at the FUB and elsewhere... " " ab WWWb http://www.belug.org/~guckes/ " ab WWWm http://www.math.fu-berlin.de/~guckes/ " ab WWWi http://www.inf.fu-berlin.de/~guckes/ " ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/ "" " WWW Pages base URLs " " ab HPA http://www.math.fu-berlin.de/~guckes/afw/ " ab HPa http://www.math.fu-berlin.de/~guckes/ascii/ " ab HPc http://www.math.fu-berlin.de/~guckes/calvin/ " ab HPD http://www.math.fu-berlin.de/~guckes/dos/ " ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html " ab HPE http://www.math.fu-berlin.de/~guckes/elm/ " ab HPI http://www.math.fu-berlin.de/~guckes/irc/ " ab HPi http://www.math.fu-berlin.de/~guckes/ispell/ " ab HPL http://www.math.fu-berlin.de/~guckes/lynx/ " ab HPl http://www.math.fu-berlin.de/~guckes/less/ " ab HPm http://www.math.fu-berlin.de/~guckes/mail/ " ab HPM http://www.math.fu-berlin.de/~guckes/mutt/ " ab HPN http://www.math.fu-berlin.de/~guckes/nn/ " ab HPP http://www.math.fu-berlin.de/~guckes/pine/ " ab HPp http://www.math.fu-berlin.de/~guckes/procmail/ " ab HPr http://babayaga.math.fu-berlin.de/~rxvt/ " ab HPR http://www.math.fu-berlin.de/~guckes/rfc/ " ab HPs http://www.math.fu-berlin.de/~guckes/screen/ " ab HPS http://www.math.fu-berlin.de/~guckes/slrn/ " ab HPv http://www.math.fu-berlin.de/~guckes/vi/ "" HPOV - the "original" URL of the Vim Home Page! " ab HPOV http://www.math.fu-berlin.de/~guckes/vim/ " ab HPV http://www.vim.org/ " ab HPX http://www.math.fu-berlin.de/~guckes/xmas/ " ab HPZ http://www.math.fu-berlin.de/~guckes/zsh/ "" "" Other important WWW addresses " " ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/ " ab URLaltavista http://altavista.digital.com/ " ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/ " ab URLvimfaq http://www.grafnetix.com/~laurent/vim/faq.html " ab URLbambi http://www.math.fu-berlin.de/~leitner/CnH/bambi.html " ab URLsecret http://www.math.fu-berlin.de/~leitner/CnH/secret.html " ab URLwhome http://www.math.fu-berlin.de/~leitner/CnH/who.me.html " ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg " ab FTPFUB ftp://ftp.fu-berlin.de/ " ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/ "" "" =================================================================== " Abbreviations - Header Lines for Email and News " =================================================================== " Define regexpr for headers to use with mappings " as it makes reading the mappings much easier: " cab HADDR From\\|Cc\\|To cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\) cab HNEWS ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\) " " =================================================================== " Abbreviations - General Editing - Inserting Dates and Times " =================================================================== " " First, some command to add date stamps (with and without time). " I use these manually after a substantial change to a webpage. " [These abbreviations are used with the mapping for ",L".] " iab Ydate =strftime("%y%m%d") " Example: 971027 " iab Ytime =strftime("%H:%M") " Example: 14:28 " iab YDT =strftime("%y%m%d %T") " Example: 971027 12:00:00 " iab YDATE =strftime("%a %b %d %T %Z %Y") " Example: Tue Dec 16 12:07:00 CET 1997 " " On Windows the functions "strftime" seems to have a different " format. Therefore the following may be necessary: [980730] " if !has("unix") " iab YDATE =strftime("%c %a") " else " iab YDATE =strftime("%D %T %a") " endif " " =================================================================== " MAPpings " =================================================================== " Caveat: Mapping must be "prefix free", ie no mapping must be the " prefix of any other mapping. Example: "map ,abc foo" and " "map ,abcd bar" will give you the error message "Ambigous mapping". " " The backslash ('\') is the only(?) unmapped key, so this is the best " key to start mappings with as this does not take away a command key. " However, the backslash is never in the same position with keyboards. " Eg on German keyboards it is AltGr-sz - don't ask. " Anyway, I have decided to start mappings with the comma as this " character is always on the same position on almost all keyboards " and I hardly have a need for that command. " " The following maps get rid of some basic problems: " " When the backspace key sends a "delete" character " then you simply map the "delete" to a "backspace" (CTRL-H): " map " " With Vim-4 the format command was just 'Q' and " I am too used to it. So I need this back! nnoremap Q gq vnoremap Q gq " " 980527 I often reformat a paragraph to fit some textwidth - " and I use the following mapping to adjust it to the " current position of the cursor: map #tw :set textwidth==col(".") " " 981210 Whenever I paste some text into VIM I have to " toggle from "nopaste" to "paste" and back again: " map :set paste!:set paste? " map [14~ :set paste!:set paste? " --> new option for this: 'pastetoggle' " " "tal" is the "trailer alignment" filter program " Hopefully it will ship with Vim one day. " vmap #t !tal " vmap #t !tal -p 0 " " Disable the command 'K' (keyword lookup) by mapping it " to an "empty command". (thanks, Lawrence! :-): " map K : " map K : " More elegant: (Hi Aziz! :-) map K " " Disable the suspend for ^Z. " I use Vim under "screen" where a suspend would lose the " connection to the " terminal - which is what I want to avoid. " map :shell " " Make CTRL-^ rebound to the *column* in the previous file noremap `" " " Make "gf" rebound to last cursor position (line *and* column) " noremap gf gf`" " " When I let Vim write the current buffer I frequently mistype the " command ":w" as ":W" - so I have to remap it to correct this typo: nmap :W :w " TODO: Use the following (after some testing): " command -nargs=? -bang W w " " Are you used to the Unix commands "alias" and "which"? " I sometimes use these to look up my abbreviations and mappings. " So I need them available on the command line: map :alias map map :which map " " The command {number}CTRL-G show the current nuffer number, too. " This is yet another feature that vi does not have. " As I always want to see the buffer number I map it to CTRL-G. " Pleae note that here we need to prevent a loop in the mapping by " using the comamnd "noremap"! noremap 2 " " 980311 Sourcing syntax files " My personal syntax files are in ~/.P/vim/syntax/ " and I need a quick way to edit and source them. map ,SO :so ~/.P/vim/syntax/ " " 980706 Sourcing syntax files from the distribution " A nice and fast way to both source syntax files " and to take a look at "what's there": " map ,V :so $VIM/syntax/ map ,V :so $VIMRUNTIME/syntax/ " " 990614 Quick insertion of an empty line: " nmap o " I find this convenient - but as I am also used to proceed to " next line by pressing CR this often gives me new empty lines " when I really do not need them. :-( " " =================================================================== " Customizing the command line " =================================================================== " Valid names for keys are: " " " Many shells allow editing in "Emacs Style". " Although I love Vi, I am quite used to this kind of editing now. " So here it is - command line editing commands in emacs style: cnoremap cnoremap " cnoremap cnoremap cnoremap cnoremap cnoremap cnoremap b cnoremap cnoremap f cnoremap cnoremap " Note: More info about this is in the helptexts: :help emacs-keys " " Additional codes for that "English" keyboard at the Xterminal cnoremap [D cnoremap [C " " =================================================================== " VIM - Editing and updating the vimrc: " As I often make changes to this file I use these commands " to start editing it and also update it: if has("unix") let vimrc='~/.vimrc' else " ie: if has("dos16") || has("dos32") || has("win32") let vimrc='$VIM\_vimrc' endif nn ,u :source =vimrc nn ,v :edit =vimrc " ,v = vimrc editing (edit this file) " map ,v :e ~/.vimrc " ,u = "update" by reading this file " map ,u :source ~/.vimrc " =================================================================== " " General Editing " " Define "del" char to be the same backspace (saves a LOT of trouble!) " As the angle notation cannot be use with the LeftHandSide " with mappings you must type this in *literally*! " map 127 "cmap 127 " the same for Linux Debian which uses " imap [3~ " imap  " cmap  " " ;rcm = remove "control-m"s - for those mails sent from DOS: cmap ;rcm %s///g " " Make whitespace visible: " Sws = show whitespace nmap ,Sws :%s/ /_/g vmap ,Sws :%s/ /_/g " " Sometimes you just want to *see* that trailing whitespace: " Stws = show trailing whitespace nmap ,Stws :%s/ *$/_/g vmap ,Stws :%s/ *$/_/g " " General Editing - Turning umlauts into ascii (for German keyboards) " " imap ä ae " imap ö oe " imap ü ue " imap ß ss " " Ä -> Ä :%s/\Ä/Ä/gc -> D " Ö -> Ö :%s/\Ö/Ö/gc -> V " Ü -> Ü :%s/\Ü/Ü/gc -> \ " ä -> ä :%s/\ä/ä/gc -> d " ö -> ö :%s/\ö/ö/gc -> v " ü -> ü :%s/\ü/ü/gc -> | " " =================================================================== " Inserting Dates and Times / Updating Date+Time Stamps " =================================================================== " ,L = "Last updated" - replace old time stamp with a new one " preserving whitespace and using internal "strftime" command: " requires the abbreviation "YDATE" map ,L 1G/Last update:\s*/e+1CYDATE map ,,L 1G/Last change:\s*/e+1CYDATE " Example: " before: "Last update: Thu Apr 6 12:07:00 CET 1967" " after: "Last update: Tue Dec 16 12:07:00 CET 1997" " " ,L = "Last updated" - replace old time stamp with a new one " using external "date" command (not good for all systems): " map ,L 1G/Last update: */e+1D:r!datekJ " " =================================================================== " General Editing - link to program "screen" " =================================================================== " " ,Et = edit temporary file of "screen" program map ,Et :e /tmp/screen-exchange " as a user of Unix systems you *must* have this program! " see also: http://www.math.fu-berlin.de/~guckes/screen/ " " Email/News - Editing replies/followups " " Part 1 - prepare for editing " " Part 2 - getting rid of empty (quoted) lines and space runs. " " ,cel = "clear empty lines" " - delete the *contents* of all lines which contain only whitespace. " note: this does not delete lines! " map ,cel :g/^[ ]*$/d map ,cel :%s/^\s\+$// " ,del = "delete 'empty' lines" " - delete all lines which contain only whitespace " note: this does *not* delete empty lines! map ,del :g/^\s\+$/d " " ,cqel = "clear quoted empty lines" " Clears (makes empty) all lines which start with '>' " and any amount of following spaces. " nmap ,cqel :%s/^[> ]*$// " vmap ,cqel :s/^[> ]*$// " nmap ,cqel :%s/^[> ]\+$// " vmap ,cqel :s/^[> ]\+$// nmap ,cqel :%s/^[>]\+$// vmap ,cqel :s/^[> ]\+$// " NOTE: If the meta sequence "\s" " The following do not work as "\s" is not a character " and thus cannot be part of a "character set". " map ,cqel :g/^[>\s]\+$/d " " Some people have strange habits within their writing. " But if you cannot educate them - rewrite their text! ;-) " " Jason "triple-dots" King elephant@onaustralia.com.au " does uses ".." or "..." rather than the usual punctuation " (comma, semicolon, colon, full stop). So... " " Turning dot runs with following spaces into an end-of-sentence, " ie dot-space-space: vmap ,dot :s/\.\+ \+/. /g " " Gary Kline (kline@tera.tera.com) indents his " own text in replies with TAB or spaces. " Here's how to get rid of these indentation: vmap ,gary :s/^>[ ]\+\([^>]\)/> \1/ " " ,ksr = "kill space runs" " substitutes runs of two or more space to a single space: " nmap ,ksr :%s/ */ /g " vmap ,ksr :s/ */ /g nmap ,ksr :%s/ \+/ /g vmap ,ksr :s/ \+/ /g " Why can't the removal of space runs be " an option of "text formatting"? *hrmpf* " " ,Sel = "squeeze empty lines" " Convert blocks of empty lines (not even whitespace included) " into *one* empty line (within current visual): map ,Sel :g/^$/,/./-j " " ,Sbl = "squeeze blank lines" " Convert all blocks of blank lines (containing whitespace only) " into *one* empty line (within current visual): " map ,Sbl :g/^\s*$/,/[^ ]/-j " map ,Sbl :g/^\s*$/,/[^ \t]/-j map ,Sbl :g/^\s*$/,/\S/-j " " =================================================================== " Editing of email replies and Usenet followups - using autocommands " =================================================================== " " Remove ALL auto-commands. This avoids having the " autocommands twice when the vimrc file is sourced again. autocmd! " " Let Vim identify itself in the message header " when editing emails with Mutt: au! BufNewFile mutt* let @"="X-Editor: Vim-".version." http://www.vim.org\n"|exe 'norm 1G}""P' " " set the textwidth to 70 characters for replies (email&usenet) au BufNewFile,BufRead .letter,mutt*,nn.*,snd.* set tw=70 " " Some more autocommand examples which set the values for " "autoindent", "expandtab", "shiftwidth", "tabstop", and "textwidth": " au BufEnter *.[ch] set ai et sw=4 ts=4 " au BufEnter *.pl set ai et sw=4 ts=4 " au BufEnter *.html set ai sw=2 ts=2 " au BufEnter *.shtml set ai sw=2 ts=2 " au BufEnter *.java set ai sw=4 ts=4 " au BufEnter */drafts/* set tw=72 " Examples used by talg@CS.Berkeley.edu - thanks! " " Try to use the mapping ",D" when doing a followup. " autocmd BufNewFile ~/.followup ,D| " " Part 3 - Change Quoting Level " " ,dp = de-quote current inner paragraph " map ,dp {jma}kmb:'a,'bs/^> // map ,dp vip:s/^> // vmap ,dp :s/^> // " " ,qp = quote current paragraph " jump to first inner line, mark with 'a'; " jump to last inner line, mark with 'b'; " then do the quoting as a substitution " on the line range "'a,'b": " map ,qp {jma}kmb:'a,'bs/^/> / " vim-5 now has selection of "inner" and "all" " of current text object - mapping commented! " " ,qp = quote current paragraph (old version) " jump to first inner line, Visual, " jump to last inner line, " then do the quoting as a substitution: " map ,qp {jV}k:s/^/> / " " ,qp = quote current inner paragraph (works since vim-5.0q) " select inner paragraph " then do the quoting as a substitution: map ,qp vip:s/^/> / " " ,qp = quote current paragraph " just do the quoting as a substitution: vmap ,qp :s/^/> / " " ## = comment current inner paragraph with '#': nmap ## vip:s/^/#/ vmap ## :s/^/#/ " " Changing quote style to *the* true quote prefix string "> ": " " Fix Supercite aka PowerQuote (Hi, Andi! :-): " before ,kpq: > Sven> text " after ,kpq: > > text " ,kpq kill power quote vmap ,kpq :s/^> *[a-zA-Z]*>/> >/ " " Fix various other quote characters: " ,fq "fix quoting" vmap ,fq :s/^> \([-":}\|][ ]\)/> > / " " Part 4 - Weed Headers of quoted mail/post " " These mappings make use of the abbreviation that define a list of " Email headers (HEMAIL) and News headers (HNEWS): nmap ,we vip:v/HEMAIL/d vmap ,we :v/HEMAIL/d nmap ,wp vip:v/HNEWS/d vmap ,wp :v/HNEWS/d " " Old versions for vim-4.6: " ,we = "weed email header" " nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" " vmap ,we !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" " ,wp = "weed post header" " nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" " vmap ,wp !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" " " ,ri = "Read in" basic lines from the email header " Useful when replying to an email: " nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:" " NOTE: "readmsg" ships with the mailer ELM. " " " Part 5 - Reformatting Text " " NOTE: The following mapping require formatoptions to include 'r' " and "comments" to include "n:>" (ie "nested" comments with '>'). " " Formatting the current paragraph according to " the current 'textwidth' with ^J (control-j): imap gqap map gqap " " Here is a variation of this command. It inserts the character " CTRL-Z at the current position to enable to rebound to the " previous position within the text. [Hello, Y. K. Puckett!] " map igqip?x " imap gqip?xi " " ,b = break line in commented text (to be used on a space) " nmap ,b dwi> nmap ,b r " ,j = join line in commented text " (can be used anywhere on the line) " nmap ,j Jxx nmap ,j Vjgq " " ,B = break line at current position *and* join the next line " nmap ,B i>Jxx nmap ,B rVjgq " " ,,, break current line at current column, " inserting ellipsis and "filling space": " nmap ,,, ,,1,,2 " nmap ,,1 a...X...FXrlmaky$o" " nmap ,,2 :s/./ /g3X0"yy$dd`a"yP " " " =================================================================== " Edit your reply! (Or else!) " =================================================================== " " Part 6 - Inserting Special or Standard Text " Part 6a - The header " Add adresses for To: and Cc: lines " " ,ca = check alias (reads in expansion of alias name) " map ,ca :r!elmalias -f "\%v (\%n)" " ,Ca = check alias (reads in expansion of alias name) " map ,Ca :r!elmalias -f "\%n <\%v>" " " ,cc = "copy notice" " Insert a Cc line so that person will receive a "courtesy copy"; " this tells the addressee that text is a copy of a public article. " This assumes that there is exactly one empty line after the first " paragraph and the first line of the second paragraph contains the " return address with a trailing colon (which is later removed). map ,cc 1G}jyykPICc: $x " map ,cc ma1G}jy/ writes'aoCc: $p " " ,mlu = make letter urgent (by giving the "Priority: urgent") map ,mlu 1G}OPriority: urgent " " Fixing the From: line " " ,cS = change Sven's address. map ,cS 1G/^From: /e+1CSven Guckes " Used when replying as the "guy from vim". " " Fixing the Subject line " " Pet peeve: Unmeaningful Subject lines. Change them! " ,cs = change Subject: line map ,cs 1G/^Subject: yypIX-Old--W " This command keeps the old Subject line in "X-Old-Subject:" - " so the recipient can still search for it and " you keep a copy for editing. " " " ,re : Condense multiple "Re:_" to just one "Re:": map ,re 1G/^Sub:s/\(Re: \)\+/Re: / " " ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines: map ,Re 1G/^Subject: :s/Re: Re\[\([0-9]\+\)\]/Re[\1]/ " " Put parentheses around "visual text" " Used when commenting out an old subject. " Example: " Subject: help " Subject: vim - using autoindent (Re: help) " " ,) and ,( : vmap ,( v``>a) vmap ,) v``>a) " " Part 6 - Inserting Special or Standard Text " Part 6a - Start of text - saying "hello". " " ,hi = "Hi!" (indicates first reply) map ,hi 1G}oHi! " " ,ha = "helloagain" (indicates reply to reply) map ,ha 1G}oHello, again! " " ,H = "Hallo, Du!" (German equivalent of "hi!" for replies) " map ,H G/Quoting /e+1ye1G}oHallo, !Po map ,H G/^\* /e+1ye1G}oHallo, !Po " " " Part 6 - Inserting Special or Standard Text " Part 6b - End of text - dealing with "signatures". " " remove signatures " " ,kqs = kill quoted sig (to remove those damn sigs for replies) " goto end-of-buffer, search-backwards for a quoted sigdashes " line, ie "^> -- $", and delete unto end-of-paragraph: map ,kqs G?^> -- $d} " map ,kqs G?^> *-- $dG " ,kqs = kill quoted sig unto start of own signature: " map ,kqs G?^> *-- $d/^-- $/ " " =================================== " Adding quotes and signatures easily " =================================== " " QUOTES: http://www.math.fu-berlin.de/~guckes/quotes/collection " " Decide which quote file to use: if filereadable("~/.P/quotes/collection") let QUOTES=expand("~/.P/quotes/collection") else " use a copy in the homedir: let QUOTES=expand("~/.quotes") endif " " ,aq = "add quote" " Reads in a quote from my favourite quotations: " nmap ,aq :r!agrep -d "^-- $" ~/.P/quotes/collectionb nmap ,aq :exe ":r!agrep -d '^-- $' ".QUOTES " " SIGNATURES: http://www.math.fu-berlin.de/~guckes/sig/SIGS " let SIGS=expand("~/.P/sig/SIGS") if !filereadable(SIGS) " use a copy in the homedir: let SIGS=expand("~/.signatures") endif " " ,s = "sign" - " Read in signature file (requires manual completion): " nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS nmap ,s :exe ":r!agrep -d '^-- $' ".SIGS " " SEE ALSO: " Sven's page on sigs: http://www.math.fu-berlin.de/~guckes/sig/ " Sven's page on agrep: http://www.math.fu-berlin.de/~guckes/agrep/ " " ,at = "add text" - " read in text file (requires manual completion): nmap ,at :r ~/.P/txt/ " " MUTT: Auto-kill signatures for replies " map ,kqs G?^> *-- $dG " autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs " " At the end of editing your reply you should check your spelling " with the spelling checker "ispell". " These mappings are from Lawrence Clapp lclapp@iname.com: " spellcheck the document -- skip quoted text " nmap :w ! grep -v '^>' \| spell " vmap :w ! grep -v '^>' \| spell " At home under Linux it looks something more like this: " nmap :w ! grep -v '^>' \| ispell -??? " " Tell the recipient that I was replying to an old email of his: ab SvenR Sven [finally takeing the time to reply to old emails] " " Toggles: [todo] " " toggle autoindent " toggle hlsearch " cycle textwidth between values 60, 70, 75, 80 " " =================================================================== " LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX " =================================================================== " This has become quite big - so I moved it out to another file: " http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim let FILE="/home/robinson/emailer/guckes/.P/vim/source/latex.vim" if filereadable(FILE) let RESULT="file readable" exe "source " . FILE else let RESULT="file not readable" endif " " =================================================================== " PGP - encryption and decryption " =================================================================== " " encrypt map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty' " decrypt map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty' " sign map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' map ;v :,/^-----END/w !pgp -m " " PGP - original mappings " " encrypt and sign (useful for mailing to someone else) "csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4' " sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4 " " sign (useful for mailing to someone else) "csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' " sh: map #2 :,$! pgp -fast +clear 2>/dev/tty " " decrypt "csh: map #3 :/^-----BEG/,/^-----END/!\ " /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4' " sh: map #3 :/^-----BEG/,/^-----END/!\ " pgp -f 2>/dev/tty^V|^V|sleep 4 " " view (pages output, like more) "csh: map #4 :,/^-----END/w !pgp -m " sh: map #4 :,/^-----END/w !pgp -m " " encrypt alone (useful for encrypting for oneself) "csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4' " sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4 " " Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says : " The significant feature is that stderr is redirected independently " of stdout, and it is redirected to /dev/tty which is a synonym for " the current terminal on Unix. I don't know why the ||sleep 4 " stuff is there, but it is harmless so I left it. Since csh is such " junk, special rules are used if you are using it (tcsh, too). " ksh and bash should use the sh form. zsh, et al: consult your " manual. The # format is used to map function keys. If your " terminal does not support the requested function key, use a " literal #. Not all of the clones correctly support this. " " =================================================================== " Useful stuff. At least these are nice examples. :-) " =================================================================== " " ,t = transpose two characters: from aXb -> bXa " map ,t XplxhhPl " This macros shortened by one character by " Preben Guldberg c928400@student.dtu.dk " map ,t XpxphXp " map ,t xphXpxp " " make space move the cursor to the right - much better than a *beep* " nmap \ l " " ,E = execute line " map ,E 0/\$w"yy$:yr! " This command excutes a shell command from the current line and " reads in its output into the buffer. It assumes that the command " starts with the fist word after the first '$' (the shell prompt " of /bin/sh). Try ",E" on that line, ie place the cursor on it " and then press ",E": " $ ls -la " Note: The command line commands have been remapped to tcsh style!! " " " ,dr = decode/encode rot13 text vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m " Use this with an external "rot13" script: " " ,13 - rot13 the visual text " vmap ,13 :!rot13 " " Give the URL under the cursor to Netscape " map ,net yA:!netscape -remote "openurl "" " " " =================================================================== " Mapping of special keys - arrow keys and function keys. " =================================================================== " Buffer commands (split,move,delete) - " this makes a little more easy to deal with buffers. " (works for Linux PCs in room 030) " map :split " map :bp " map :bn " map :bd " " Buffer commands (split,move,delete) - " for Mac keyboard (Performa 5200, US keyboard) " " map [19~ :split " map [20~ :bp " map [23~ :bn " map [31~ :bd " " Obvious mappings " " map " map " " =================================================================== " FAQ: Emacs editing" " Q: How can I stay in insert mode and move around like within Emacs? " A: Get the following file and source it like it is done here: " URL: http://www.math.fu-berlin.de/~guckes/vim/source/emacs.vim let FILE="/home/robinson/emailer/guckes/.P/vim/source/emacs.vim" if filereadable(FILE) let RESULT="file readable" exe "source " . FILE else let RESULT="file not readable" endif " " Make the up and down movements move by "display/screen lines": " map j gj " map gj " map k gk " map gk " " Normal mode - tcsh style movements [960425] " " nmap 0 " nmap h " nmap x " nmap $ " nmap l " nmap b b " nmap f w " " DOS keyboard mapping for cursor keys " " map [A " map [B " map [C " map [D " imap [A " imap [B " imap [C " imap [D " " DOS keyboard " "insert" " map [1~ i " map [1~ " "home" " map [2~ ^ " map [2~ 0 " map [2~ " "pgup" " map [3~ " map [3~ " "delete" " map [4~ x " map [4~ " "end" " map [5~ $ " map [5~ " "pgdn" " map [6~ " map [6~ " " Keyboard mapping for cursor keys " [works for SUNs in Solarium (room 030) - 970815] " map OA map OB map OC map OD imap OA imap OB imap OC imap OD " " Keyboard mapping for cursor keys " [works for XTerminals - 970818] map [A map [B map [C map [D imap [A imap [B imap [C imap [D " " =================================================================== " AutoCommands " =================================================================== " " Autocommands are the key to "syntax coloring". " There's one command in your vimrc that should " load/source the file $VIM/syntax/syntax.vim " which contains the definition for colors and " the autocommands that load other syntax files " when necessary, ie when the filename matches " a given pattern, eg "*.c" or *".html". " " just load the main syntax file when Vim was compiled with "+syntax" if has("syntax") " The following sources the main syntax file, " ie. "$VIM/syntax/syntax.vim", see ":help :syn-on": syntax on " Redefine the color for "Comment": " hi! Comment term=bold ctermfg=cyan guifg=Blue endif " " Definition of an alternative syntax file: " if has("syntax") " " Define the filename patterns for mail and news: " " MAILNEWSFILES... (missing, damn) " " Define the aucommand tow work on special files: " let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES " " execute the source command: " exe aucommand." source ~guckes/.P/vim/syntax/sven.vim" " " " endif " " " EXAMPLE: Restricting mappings to some files only: " An autocommand does the macthign on the filenames - " but abbreviations are not expanded within autocommands. " Workaround: Use "exe" for expansion: " let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES " exe aucommand." :map ,hi 1G}oHi!" " exe aucommand." :map ,ha 1G}oHello, again!" " exe aucommand." :map ,H G/Quoting /e+1ye1G}oHallo, !Po" " exe aucommand." :map ,re 1G}oRe!" " " Automatically place the cursor onto the first line of the mail body: " autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j " " Toggle syntax coloring on/off with "__": " nn __ mg:if has("syntax_items")syn clearelsesyn onen`g " Note: It works - but the screen flashes are quite annoying. :-/ " " " =================================================================== " EXAMPLES " =================================================================== " " Visualizing trailing whitespace: " :set hls " /\s\+$ " " Toggling a numerical variable between two values. " Example: Switch the textwidth (tw) between values "70" and "80": " map \1 :let &tw = 150 - &tw " " Capitalizing the previously typed word, " returning to the previous position: " imap CAP mzB~`za " " Uppercasing the previously typed word, " returning to the previous position: " imap CAP mzvBU`za " imap CAP mzBvaWU`za " " =================================================================== " TEMPORARY STUFF - TESTING THINGS " =================================================================== " " View a html document (or part of it) with lynx. You need " a system that supports the /def/fd/* file descriptors :-( "nmap ,ly :w !lynx -force_html /dev/fd/0 "vmap ,ly :w !lynx -force_html /dev/fd/0 " " Fri Jun 19 19:19:19 CEST 1998 " Hi, Vikas! vikasa@att.com " The key produces the code "OD" and Vikas wants to make " Vim jump back one word in normal mode, ie using the command 'b': " nmap OD b " Works for me! :-) " " Some simple example of the "expand modifiers": " insert the current filename *with* path: iab YPATHFILE =expand("%:p") " insert the current filename *without* path: iab YFILE =expand("%:t:r") " insert the path of current file: iab YPATH =expand("%:h") " " #b = "browse" - send selected URL to Netscape vmap #b y:!netscape -remote "openurl "" " " Toggle highlight search and report the current value: " map #1 :set hls! " map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3) " map ## #1#2 " " Sorting current line containing a list of numbers " map ## :s/ //gvip!sort -n " " Replying to the mutt mailing list: " Remove header lines Cc: and Bcc: and insert [mutt] at the beginning " map ,MM 1G/^Cc:2dd}o[mutt] " " map ,U %s###gc " map ,F {jma}kmb:'a,'b!sed -e "s/^>//"|\ " sed -f ~/.P/elm/scripts/weedout.sed " map ,mb ebiEadw " " stripping netscape bookmarks and making them list items " vmap ,ns :.,$s/^ *
<\(A.*"\) ADD.*">\(.*\)$/
  • <\1>\2/ " " Jump to the last space before the 80th column. " map ,\| 80\|F " " extracting variable names from mutt's init.c " :%s/^.*"\([a-z0-9_]*\)".*$/\1/ " " \<> = change to <> notation by substituting ^M and ^[ " cab \<> s///gc:s///gc " " Changing the From_ line in pseudo mail folders to an appropriate " value - so you can read them with a mailer. " %s/^From /From guckes Thu Apr 6 12:07:00 1967/ " " =================================================================== " ASCII tables - you may need them some day. Save them to a file! " =================================================================== " " ASCII Table - | octal value - name/char | " " |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| " |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si | " |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb| " |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us | " |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' | " |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / | " |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 | " |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? | " |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G | " |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O | " |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W | " |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ | " |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g | " |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o | " |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w | " |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del| " " =================================================================== " ASCII Table - | decimal value - name/char | " " |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| " |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si | " |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb| " |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us | " |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' | " |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / | " |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 | " |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? | " |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G | " |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O | " |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W | " |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ | " |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g | " |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o | " |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w | " |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del| " " =================================================================== " ASCII Table - | hex value - name/char | " " | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel| " | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si | " | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb| " | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us | " | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' | " | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / | " | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 | " | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? | " | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G | " | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O | " | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W | " | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ | " | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g | " | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o | " | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w | " | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del| " =================================================================== " " =================================================================== " If your read this... " =================================================================== " ... then please send me an email! Thanks! --Sven guckes@vim.org " I have received some emails so far - thanks, folks! " Enjoy Vim! :-) " =================================================================== " Yet another example for an autocommand: [980616] " au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!" " =================================================================== " Last but not least... " ===================================================== " The last line is allowed to be a "modeline" with my setup. " It gives vim commands for setting variable values that are " specific for editing this file. Used mostly for setting " the textwidth (tw) and the "shiftwidth" (sw). " Note that the colon within the value of "comments" needs to " be escaped with a backslash! (Thanks, Thomas!) " vim:tw=70 et sw=4 comments=\:\" " This fixes the backspace key on Solaris boxes :set t_kb= :fixdel hi! Constant ctermfg=DarkRed hi! identifier ctermfg=DarkGreen hi! NonText ctermfg=DarkGrey hi! statement ctermfg=DarkYellow hi! preproc ctermfg=Blue hi! Normal ctermfg=Grey